PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_486D0D865.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 335aa    MW: 35799.6 Da    PI: 9.5348
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_486D0D865.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.91e-171762147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           +g+W++eEd+ l ++v ++G ++W++I++ ++ gR++k+c++rw + 
  Traes_5BL_486D0D865.1 17 KGPWSPEEDDALQRLVGRHGARNWSLISKSIP-GRSGKSCRLRWCNQ 62
                           79******************************.***********985 PP

2Myb_DNA-binding51.81.8e-1671113347
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            ++T++Ed+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  Traes_5BL_486D0D865.1  71 PFTPDEDDTILRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 113
                            89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.7161267IPR017930Myb domain
SuperFamilySSF466893.07E-3114110IPR009057Homeodomain-like
SMARTSM007171.0E-151665IPR001005SANT/Myb domain
PfamPF002491.4E-171762IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-251870IPR009057Homeodomain-like
CDDcd001675.29E-151961No hitNo description
SMARTSM007177.2E-1468116IPR001005SANT/Myb domain
PROSITE profilePS5129419.74769118IPR017930Myb domain
PfamPF002495.6E-1471113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2371117IPR009057Homeodomain-like
CDDcd001674.14E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAACRGGGGG KDVDRIKGPW SPEEDDALQR LVGRHGARNW SLISKSIPGR SGKSCRLRWC  60
NQLSPQVEHR PFTPDEDDTI LRAHARFGNK WATIARLLSG RTDNAIKNHW NSTLKRKYSS  120
SSSASASPAE DGAAMADDED RRPLKRTSSD GYPGLCFSPG SPSGSDLSDS SHQSLPSVMP  180
SAASQQPHVY RPVARAGGVV VLPTATPQPP QPSPPSPPPP PPPPATSLSL SLSLPGLDAP  240
EPAPVAQPMS MPPPPAPVQP AAAPQMPPPP PMPFQLQPPP QPQPRTAAPF NGEFLSMMQE  300
MIRIEVRNYM SGFDPRSPAD GVHAAKRMMS MAKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-38141174107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00632PBMTransfer from PK28565.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3552410.0AK355241.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1018A13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151336.11e-129sucrose responsive element binding protein
SwissprotQ9FDW13e-82MYB44_ARATH; Transcription factor MYB44
TrEMBLW5FAS40.0W5FAS4_WHEAT; Uncharacterized protein
STRINGMLOC_64817.11e-141(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.13e-66myb domain protein 70
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]